Springen naar inhoud

[biologie, scheikunde] epo


  • Log in om te kunnen reageren

#1

gentledaisy

    gentledaisy


  • >25 berichten
  • 71 berichten
  • Ervaren gebruiker

Geplaatst op 30 maart 2009 - 08:25

Hallo,
Weet iemand de stuctuurformule van EPO. Of eventueel de engelse benaming.
Bedankt.

Dit forum kan gratis blijven vanwege banners als deze. Door te registeren zal de onderstaande banner overigens verdwijnen.

#2

bokkelellie

    bokkelellie


  • 0 - 25 berichten
  • 4 berichten
  • Gebruiker

Geplaatst op 30 maart 2009 - 08:29

heb je hier al gekeken??

Link

#3

Gesp

    Gesp


  • >250 berichten
  • 339 berichten
  • Ervaren gebruiker

Geplaatst op 30 maart 2009 - 08:30

Engelse benaming: erythropoietin
Het is een eiwit, dus een structuurformule is lastig. Een aminozuurvolgorde zou misschien nog gaan.

#4

Jona444

    Jona444


  • >1k berichten
  • 1409 berichten
  • Ervaren gebruiker

Geplaatst op 30 maart 2009 - 09:40

Geplaatste afbeelding
Its supercalifragilisticexpialidocious!

#5

Wouter_Masselink

    Wouter_Masselink


  • >5k berichten
  • 8252 berichten
  • VIP

Geplaatst op 30 maart 2009 - 10:06

in FASTA format

>gi|219518752|gb|AAI43226.1| EPO protein [Homo sapiens]
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPD
TKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALG
AQEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR


http://www.ncbi.nlm.nih.gov/protein/219518...g$=seqview
"Meep meep meep." Beaker





0 gebruiker(s) lezen dit onderwerp

0 leden, 0 bezoekers, 0 anonieme gebruikers

Ook adverteren op onze website? Lees hier meer!

Gesponsorde vacatures

Vacatures