Springen naar inhoud


  • Log in om te kunnen reageren




  • >25 berichten
  • 49 berichten
  • Gebruiker

Geplaatst op 24 maart 2006 - 21:51

Bevat insuline de volgende aminozuren?
glutamine ,glycine,methionine

Vegetariers die geen dierlijke producten ete, zullen nooit insuline in hun voeding hebbe.Vermits ze geen rood vlees eten ,zullen ze ook nooit de rode bloedkleurstof
hemoglobine innemen .Toch zijn bij vegetariers de levensnoodzakelijke eiwitten insuline en hemoglobine in voldoende mate in hun lichaam aanwezig ,hoe komt dit eigelijk? :wink:

Dit forum kan gratis blijven vanwege banners als deze. Door te registeren zal de onderstaande banner overigens verdwijnen.




  • >250 berichten
  • 824 berichten
  • Ervaren gebruiker

Geplaatst op 24 maart 2006 - 21:59

Eiwitten worden door het lichaam geproduceerd uit losse aminozuren. Zo lang je maar van alle essentiele aminozuren voldoende binnenkrijgt via de voeding (dierlijk of plantaardig maakt dan niet uit) kun je alle eiwitten maken die je nodig hebt, ook insuline en hemoglobine.
Overigens, zelfs al zou je insuline via het voedsel binnenkrijgen (wat niet of nauwelijks gebeurt) dan nog zou je het niet kunnen gebruiken omdat het wordt afgebroken tot aminozuren, die vervolgens dus weer gebruikt kunnen worden voor het maken van andere eiwitten.
Ik wou dat ik een elektron was, dan kon ik altijd paren




  • >1k berichten
  • 4220 berichten
  • VIP

Geplaatst op 24 maart 2006 - 22:43

Waarom noem je specifiek Hb en insuline?
Zoals Bas al aangeeft worden alle eiwitten die je eet eers afgebroken tot aminozuren (AZ). Later worden ze in een cel, in de juiste volgorde weer aan elkaar gehangen.
Als je dit weet, kan je dan andere bronnen van de drie AZ die je noemde bedenken?
Of course, the theory of relativity only works if you're going west.




  • >5k berichten
  • 8302 berichten
  • VIP

Geplaatst op 24 maart 2006 - 22:48

insuline bestaat uit de volgende aminozuren: mapwmhlltvlallalwgpn svqayssqhlcgsnlvealymtcgrsgfyrphdrreledlqveqaelgleagglqpsalemilqkrgivdqccnnictfn

"Meep meep meep." Beaker




  • >25 berichten
  • 49 berichten
  • Gebruiker

Geplaatst op 25 maart 2006 - 13:08

insuline bestaat uit de volgende aminozuren: mapwmhlltvlallalwgpn svqayssqhlcgsnlvealymtcgrsgfyrphdrreledlqveqaelgleagglqpsalemilqkrgivdqccnnictfn


Wat is dit ik snap er niks van




  • >1k berichten
  • 4220 berichten
  • VIP

Geplaatst op 25 maart 2006 - 14:03

Als je in google "amino acid" intikt, krijg je een lijst met afkortingen van de verschillende AZ. Zo zijn try, phe en tyr gebruikelijke afkortingen..

Zoek op bijvoorbeeld "amino acid + insulin" en je zult de AZ-sequentie van insuline vast vinden.
Of course, the theory of relativity only works if you're going west.




  • >25 berichten
  • 49 berichten
  • Gebruiker

Geplaatst op 25 maart 2006 - 18:09

kan het zijn dat het glycine bevat en nie glutamine ,methionine?




  • >1k berichten
  • 4220 berichten
  • VIP

Geplaatst op 25 maart 2006 - 21:01

Anders doe je er zelf even wat moeite voor...

amino acid sequence insulin
Derde hit bij google (afbeeldingen)
Of course, the theory of relativity only works if you're going west.




  • >1k berichten
  • 3149 berichten
  • VIP

Geplaatst op 26 maart 2006 - 05:31

je maakt zelf ook aminozuren aan, niet alle, maar de cel kan er een hele rits zelf aanmaken. E.coli's kunnen er op worden gekweekt: het genoom kan zo worden aangepast dat er een bepaald aminozuur niet meer wordt aangemaakt.
Appareo decet nihil munditia?

0 gebruiker(s) lezen dit onderwerp

0 leden, 0 bezoekers, 0 anonieme gebruikers

Ook adverteren op onze website? Lees hier meer!

Gesponsorde vacatures
